HBA1 polyclonal antibody (A01)
  • HBA1 polyclonal antibody (A01)

HBA1 polyclonal antibody (A01)

Ref: AB-H00003039-A01
HBA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HBA1.
Información adicional
Size 50 uL
Gene Name HBA1
Gene Alias HBH|HBA-T3
Gene Description hemoglobin, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HBA1 (NP_000549, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3039

Enviar uma mensagem


HBA1 polyclonal antibody (A01)

HBA1 polyclonal antibody (A01)