HARS monoclonal antibody (M03A), clone 4D4
  • HARS monoclonal antibody (M03A), clone 4D4

HARS monoclonal antibody (M03A), clone 4D4

Ref: AB-H00003035-M03A
HARS monoclonal antibody (M03A), clone 4D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HARS.
Información adicional
Size 200 uL
Gene Name HARS
Gene Alias FLJ20491|HRS
Gene Description histidyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 3035
Clone Number 4D4
Iso type IgG2a Kappa

Enviar uma mensagem


HARS monoclonal antibody (M03A), clone 4D4

HARS monoclonal antibody (M03A), clone 4D4