HARS monoclonal antibody (M01), clone 1C8
  • HARS monoclonal antibody (M01), clone 1C8

HARS monoclonal antibody (M01), clone 1C8

Ref: AB-H00003035-M01
HARS monoclonal antibody (M01), clone 1C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HARS.
Información adicional
Size 100 ug
Gene Name HARS
Gene Alias FLJ20491|HRS
Gene Description histidyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3035
Clone Number 1C8
Iso type IgG2a Kappa

Enviar uma mensagem


HARS monoclonal antibody (M01), clone 1C8

HARS monoclonal antibody (M01), clone 1C8