HARS polyclonal antibody (A01)
  • HARS polyclonal antibody (A01)

HARS polyclonal antibody (A01)

Ref: AB-H00003035-A01
HARS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HARS.
Información adicional
Size 50 uL
Gene Name HARS
Gene Alias FLJ20491|HRS
Gene Description histidyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HARS (NP_002100, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3035

Enviar uma mensagem


HARS polyclonal antibody (A01)

HARS polyclonal antibody (A01)