HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)
  • HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)

HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003024-D01P
HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HIST1H1A protein.
Información adicional
Size 100 ug
Gene Name HIST1H1A
Gene Alias H1.1|H1F1|HIST1|MGC126642|MGC138345
Gene Description histone cluster 1, H1a
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HIST1H1A (NP_005316.1, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3024

Enviar uma mensagem


HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)

HIST1H1A purified MaxPab rabbit polyclonal antibody (D01P)