H2AFX monoclonal antibody (M17), clone 2H5
  • H2AFX monoclonal antibody (M17), clone 2H5

H2AFX monoclonal antibody (M17), clone 2H5

Ref: AB-H00003014-M17
H2AFX monoclonal antibody (M17), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant H2AFX.
Información adicional
Size 100 ug
Gene Name H2AFX
Gene Alias H2A.X|H2A/X|H2AX
Gene Description H2A histone family, member X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen H2AFX (AAH11694.1, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3014
Clone Number 2H5
Iso type IgG2a Kappa

Enviar uma mensagem


H2AFX monoclonal antibody (M17), clone 2H5

H2AFX monoclonal antibody (M17), clone 2H5