H2AFX monoclonal antibody (M05), clone 3F4
  • H2AFX monoclonal antibody (M05), clone 3F4

H2AFX monoclonal antibody (M05), clone 3F4

Ref: AB-H00003014-M05
H2AFX monoclonal antibody (M05), clone 3F4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant H2AFX.
Información adicional
Size 100 ug
Gene Name H2AFX
Gene Alias H2A.X|H2A/X|H2AX
Gene Description H2A histone family, member X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen H2AFX (AAH04915, 1 a.a. ~ 143 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3014
Clone Number 3F4
Iso type IgG2a Kappa

Enviar uma mensagem


H2AFX monoclonal antibody (M05), clone 3F4

H2AFX monoclonal antibody (M05), clone 3F4