H2AFX purified MaxPab rabbit polyclonal antibody (D01P)
  • H2AFX purified MaxPab rabbit polyclonal antibody (D01P)

H2AFX purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003014-D01P
H2AFX purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human H2AFX protein.
Información adicional
Size 100 ug
Gene Name H2AFX
Gene Alias H2A.X|H2A/X|H2AX
Gene Description H2A histone family, member X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen H2AFX (NP_002096.1, 1 a.a. ~ 143 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3014

Enviar uma mensagem


H2AFX purified MaxPab rabbit polyclonal antibody (D01P)

H2AFX purified MaxPab rabbit polyclonal antibody (D01P)