GZMM monoclonal antibody (M03), clone 4D11
  • GZMM monoclonal antibody (M03), clone 4D11

GZMM monoclonal antibody (M03), clone 4D11

Ref: AB-H00003004-M03
GZMM monoclonal antibody (M03), clone 4D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GZMM.
Información adicional
Size 100 ug
Gene Name GZMM
Gene Alias LMET1|MET1
Gene Description granzyme M (lymphocyte met-ase 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GZMM (NP_005308, 85 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3004
Clone Number 4D11
Iso type IgG2a Kappa

Enviar uma mensagem


GZMM monoclonal antibody (M03), clone 4D11

GZMM monoclonal antibody (M03), clone 4D11