GYS2 monoclonal antibody (M06), clone 8H3
  • GYS2 monoclonal antibody (M06), clone 8H3

GYS2 monoclonal antibody (M06), clone 8H3

Ref: AB-H00002998-M06
GYS2 monoclonal antibody (M06), clone 8H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GYS2.
Información adicional
Size 100 ug
Gene Name GYS2
Gene Alias -
Gene Description glycogen synthase 2 (liver)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GYS2 (NP_068776.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2998
Clone Number 8H3
Iso type IgG2a Kappa

Enviar uma mensagem


GYS2 monoclonal antibody (M06), clone 8H3

GYS2 monoclonal antibody (M06), clone 8H3