GUK1 polyclonal antibody (A01)
  • GUK1 polyclonal antibody (A01)

GUK1 polyclonal antibody (A01)

Ref: AB-H00002987-A01
GUK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GUK1.
Información adicional
Size 50 uL
Gene Name GUK1
Gene Alias GMK
Gene Description guanylate kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GUK1 (AAH06249, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2987

Enviar uma mensagem


GUK1 polyclonal antibody (A01)

GUK1 polyclonal antibody (A01)