GUCY2C polyclonal antibody (A01)
  • GUCY2C polyclonal antibody (A01)

GUCY2C polyclonal antibody (A01)

Ref: AB-H00002984-A01
GUCY2C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GUCY2C.
Información adicional
Size 50 uL
Gene Name GUCY2C
Gene Alias GUC2C|STAR
Gene Description guanylate cyclase 2C (heat stable enterotoxin receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2984

Enviar uma mensagem


GUCY2C polyclonal antibody (A01)

GUCY2C polyclonal antibody (A01)