GUCA2B purified MaxPab mouse polyclonal antibody (B01P)
  • GUCA2B purified MaxPab mouse polyclonal antibody (B01P)

GUCA2B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002981-B01P
GUCA2B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GUCA2B protein.
Información adicional
Size 50 ug
Gene Name GUCA2B
Gene Alias GCAP-II|UGN
Gene Description guanylate cyclase activator 2B (uroguanylin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GUCA2B (NP_009033.1, 1 a.a. ~ 112 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2981

Enviar uma mensagem


GUCA2B purified MaxPab mouse polyclonal antibody (B01P)

GUCA2B purified MaxPab mouse polyclonal antibody (B01P)