GUCA1B monoclonal antibody (M01), clone 5E7
  • GUCA1B monoclonal antibody (M01), clone 5E7

GUCA1B monoclonal antibody (M01), clone 5E7

Ref: AB-H00002979-M01
GUCA1B monoclonal antibody (M01), clone 5E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GUCA1B.
Información adicional
Size 100 ug
Gene Name GUCA1B
Gene Alias DKFZp686E1183|GCAP2|GUCA2
Gene Description guanylate cyclase activator 1B (retina)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQDQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GUCA1B (NP_002089, 93 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2979
Clone Number 5E7
Iso type IgG2b Kappa

Enviar uma mensagem


GUCA1B monoclonal antibody (M01), clone 5E7

GUCA1B monoclonal antibody (M01), clone 5E7