GTF3A polyclonal antibody (A01)
  • GTF3A polyclonal antibody (A01)

GTF3A polyclonal antibody (A01)

Ref: AB-H00002971-A01
GTF3A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GTF3A.
Información adicional
Size 50 uL
Gene Name GTF3A
Gene Alias AP2|TFIIIA
Gene Description general transcription factor IIIA
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF3A (NP_002088, 185 a.a. ~ 274 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2971

Enviar uma mensagem


GTF3A polyclonal antibody (A01)

GTF3A polyclonal antibody (A01)