GTF2H4 monoclonal antibody (M03), clone 4F6
  • GTF2H4 monoclonal antibody (M03), clone 4F6

GTF2H4 monoclonal antibody (M03), clone 4F6

Ref: AB-H00002968-M03
GTF2H4 monoclonal antibody (M03), clone 4F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GTF2H4.
Información adicional
Size 100 ug
Gene Name GTF2H4
Gene Alias TFB2|TFIIH
Gene Description general transcription factor IIH, polypeptide 4, 52kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF2H4 (AAH04935.1, 363 a.a. ~ 462 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2968
Clone Number 4F6
Iso type IgG2b Kappa

Enviar uma mensagem


GTF2H4 monoclonal antibody (M03), clone 4F6

GTF2H4 monoclonal antibody (M03), clone 4F6