GTF2H4 purified MaxPab mouse polyclonal antibody (B02P)
  • GTF2H4 purified MaxPab mouse polyclonal antibody (B02P)

GTF2H4 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002968-B02P
GTF2H4 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GTF2H4 protein.
Información adicional
Size 50 ug
Gene Name GTF2H4
Gene Alias TFB2|TFIIH
Gene Description general transcription factor IIH, polypeptide 4, 52kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF2H4 (NP_001508.1, 1 a.a. ~ 462 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2968

Enviar uma mensagem


GTF2H4 purified MaxPab mouse polyclonal antibody (B02P)

GTF2H4 purified MaxPab mouse polyclonal antibody (B02P)