GTF2H1 monoclonal antibody (M02), clone 4B9
  • GTF2H1 monoclonal antibody (M02), clone 4B9

GTF2H1 monoclonal antibody (M02), clone 4B9

Ref: AB-H00002965-M02
GTF2H1 monoclonal antibody (M02), clone 4B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GTF2H1.
Información adicional
Size 100 ug
Gene Name GTF2H1
Gene Alias BTF2|TFB1|TFIIH
Gene Description general transcription factor IIH, polypeptide 1, 62kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq INQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF2H1 (NP_005307, 449 a.a. ~ 548 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2965
Clone Number 4B9
Iso type IgG2a kappa

Enviar uma mensagem


GTF2H1 monoclonal antibody (M02), clone 4B9

GTF2H1 monoclonal antibody (M02), clone 4B9