GTF2H1 MaxPab rabbit polyclonal antibody (D01)
  • GTF2H1 MaxPab rabbit polyclonal antibody (D01)

GTF2H1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002965-D01
GTF2H1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GTF2H1 protein.
Información adicional
Size 100 uL
Gene Name GTF2H1
Gene Alias BTF2|TFB1|TFIIH
Gene Description general transcription factor IIH, polypeptide 1, 62kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF2H1 (NP_005307.1, 1 a.a. ~ 548 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2965

Enviar uma mensagem


GTF2H1 MaxPab rabbit polyclonal antibody (D01)

GTF2H1 MaxPab rabbit polyclonal antibody (D01)