GTF2H1 polyclonal antibody (A01)
  • GTF2H1 polyclonal antibody (A01)

GTF2H1 polyclonal antibody (A01)

Ref: AB-H00002965-A01
GTF2H1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GTF2H1.
Información adicional
Size 50 uL
Gene Name GTF2H1
Gene Alias BTF2|TFB1|TFIIH
Gene Description general transcription factor IIH, polypeptide 1, 62kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq INQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF2H1 (NP_005307, 449 a.a. ~ 548 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2965

Enviar uma mensagem


GTF2H1 polyclonal antibody (A01)

GTF2H1 polyclonal antibody (A01)