GTF2A2 monoclonal antibody (M01), clone 2B9
  • GTF2A2 monoclonal antibody (M01), clone 2B9

GTF2A2 monoclonal antibody (M01), clone 2B9

Ref: AB-H00002958-M01
GTF2A2 monoclonal antibody (M01), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GTF2A2.
Información adicional
Size 100 ug
Gene Name GTF2A2
Gene Alias HsT18745|TF2A2|TFIIA
Gene Description general transcription factor IIA, 2, 12kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GTF2A2 (AAH00287, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2958
Clone Number 2B9
Iso type IgG2a Kappa

Enviar uma mensagem


GTF2A2 monoclonal antibody (M01), clone 2B9

GTF2A2 monoclonal antibody (M01), clone 2B9