GTF2A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • GTF2A1 purified MaxPab rabbit polyclonal antibody (D01P)

GTF2A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002957-D01P
GTF2A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GTF2A1 protein.
Información adicional
Size 100 ug
Gene Name GTF2A1
Gene Alias MGC129969|MGC129970|TF2A1|TFIIA
Gene Description general transcription factor IIA, 1, 19/37kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GTF2A1 (NP_056943.1, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2957

Enviar uma mensagem


GTF2A1 purified MaxPab rabbit polyclonal antibody (D01P)

GTF2A1 purified MaxPab rabbit polyclonal antibody (D01P)