GSTZ1 purified MaxPab mouse polyclonal antibody (B01P)
  • GSTZ1 purified MaxPab mouse polyclonal antibody (B01P)

GSTZ1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002954-B01P
GSTZ1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GSTZ1 protein.
Información adicional
Size 50 ug
Gene Name GSTZ1
Gene Alias GSTZ1-1|MAAI|MAI|MGC2029
Gene Description glutathione transferase zeta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTZ1 (NP_665877.1, 1 a.a. ~ 216 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2954

Enviar uma mensagem


GSTZ1 purified MaxPab mouse polyclonal antibody (B01P)

GSTZ1 purified MaxPab mouse polyclonal antibody (B01P)