GSTT2 polyclonal antibody (A01)
  • GSTT2 polyclonal antibody (A01)

GSTT2 polyclonal antibody (A01)

Ref: AB-H00002953-A01
GSTT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSTT2.
Información adicional
Size 50 uL
Gene Name GSTT2
Gene Alias MGC182032
Gene Description glutathione S-transferase theta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSTT2 (NP_000845, 145 a.a. ~ 244 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2953

Enviar uma mensagem


GSTT2 polyclonal antibody (A01)

GSTT2 polyclonal antibody (A01)