GSTT1 polyclonal antibody (A01)
  • GSTT1 polyclonal antibody (A01)

GSTT1 polyclonal antibody (A01)

Ref: AB-H00002952-A01
GSTT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GSTT1.
Información adicional
Size 50 uL
Gene Name GSTT1
Gene Alias -
Gene Description glutathione S-transferase theta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSTT1 (AAH07065, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2952

Enviar uma mensagem


GSTT1 polyclonal antibody (A01)

GSTT1 polyclonal antibody (A01)