GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)

GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002950-D01P
GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTP1 protein.
Información adicional
Size 100 ug
Gene Name GSTP1
Gene Alias DFN7|FAEES3|GST3|PI
Gene Description glutathione S-transferase pi 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTP1 (AAH10915.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2950

Enviar uma mensagem


GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)

GSTP1 purified MaxPab rabbit polyclonal antibody (D01P)