GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002949-D01P
GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTM5 protein.
Información adicional
Size 100 ug
Gene Name GSTM5
Gene Alias GSTM5-5|GTM5
Gene Description glutathione S-transferase mu 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTM5 (NP_000842.2, 1 a.a. ~ 218 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2949

Enviar uma mensagem


GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)