GSTM3 purified MaxPab mouse polyclonal antibody (B02P)
  • GSTM3 purified MaxPab mouse polyclonal antibody (B02P)

GSTM3 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00002947-B02P
GSTM3 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GSTM3 protein.
Información adicional
Size 50 ug
Gene Name GSTM3
Gene Alias GST5|GSTB|GSTM3-3|GTM3|MGC3310|MGC3704
Gene Description glutathione S-transferase mu 3 (brain)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTM3 (NP_000840.2, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2947

Enviar uma mensagem


GSTM3 purified MaxPab mouse polyclonal antibody (B02P)

GSTM3 purified MaxPab mouse polyclonal antibody (B02P)