View larger
Mouse monoclonal antibody raised against a partial recombinant GSTA2.
AB-H00002939-M05
New product
GSTA2 monoclonal antibody (M05), clone 3D4
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | GSTA2 |
| Gene Alias | GST2|GSTA2-2|GTA2|GTH2|MGC10525 |
| Gene Description | glutathione S-transferase alpha 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | GSTA2 (AAH02895, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 2939 |
| Clone Number | 3D4 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant GSTA2.