GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002939-D01P
GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSTA2 protein.
Información adicional
Size 100 ug
Gene Name GSTA2
Gene Alias GST2|GSTA2-2|GTA2|GTH2|MGC10525
Gene Description glutathione S-transferase alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSTA2 (NP_000837.2, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2939

Enviar uma mensagem


GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)