GSR polyclonal antibody (A01)
  • GSR polyclonal antibody (A01)

GSR polyclonal antibody (A01)

Ref: AB-H00002936-A01
GSR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSR.
Información adicional
Size 50 uL
Gene Name GSR
Gene Alias MGC78522
Gene Description glutathione reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSR (NP_000628, 413 a.a. ~ 522 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2936

Enviar uma mensagem


GSR polyclonal antibody (A01)

GSR polyclonal antibody (A01)