GSK3B purified MaxPab rabbit polyclonal antibody (D01P)
  • GSK3B purified MaxPab rabbit polyclonal antibody (D01P)

GSK3B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002932-D01P
GSK3B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GSK3B protein.
Información adicional
Size 100 ug
Gene Name GSK3B
Gene Alias -
Gene Description glycogen synthase kinase 3 beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GSK3B (NP_002084.2, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2932

Enviar uma mensagem


GSK3B purified MaxPab rabbit polyclonal antibody (D01P)

GSK3B purified MaxPab rabbit polyclonal antibody (D01P)