GSK3B polyclonal antibody (A01)
  • GSK3B polyclonal antibody (A01)

GSK3B polyclonal antibody (A01)

Ref: AB-H00002932-A01
GSK3B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GSK3B.
Información adicional
Size 50 uL
Gene Name GSK3B
Gene Alias -
Gene Description glycogen synthase kinase 3 beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GSK3B (NP_002084, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2932

Enviar uma mensagem


GSK3B polyclonal antibody (A01)

GSK3B polyclonal antibody (A01)