GRM8 monoclonal antibody (M06), clone 4A7
  • GRM8 monoclonal antibody (M06), clone 4A7

GRM8 monoclonal antibody (M06), clone 4A7

Ref: AB-H00002918-M06
GRM8 monoclonal antibody (M06), clone 4A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRM8.
Información adicional
Size 100 ug
Gene Name GRM8
Gene Alias FLJ41058|GLUR8|GPRC1H|MGC126724|MGLUR8|mGlu8
Gene Description glutamate receptor, metabotropic 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM8 (NP_000836, 486 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2918
Clone Number 4A7
Iso type IgG2a Kappa

Enviar uma mensagem


GRM8 monoclonal antibody (M06), clone 4A7

GRM8 monoclonal antibody (M06), clone 4A7