GRM7 monoclonal antibody (M01A), clone 1H5
  • GRM7 monoclonal antibody (M01A), clone 1H5

GRM7 monoclonal antibody (M01A), clone 1H5

Ref: AB-H00002917-M01A
GRM7 monoclonal antibody (M01A), clone 1H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRM7.
Información adicional
Size 200 uL
Gene Name GRM7
Gene Alias FLJ40498|GLUR7|GPRC1G|MGLUR7|mGlu7
Gene Description glutamate receptor, metabotropic 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM7 (NP_000835, 431 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2917
Clone Number 1H5
Iso type IgG2a Kappa

Enviar uma mensagem


GRM7 monoclonal antibody (M01A), clone 1H5

GRM7 monoclonal antibody (M01A), clone 1H5