GRM2 monoclonal antibody (M03), clone 3H7
  • GRM2 monoclonal antibody (M03), clone 3H7

GRM2 monoclonal antibody (M03), clone 3H7

Ref: AB-H00002912-M03
GRM2 monoclonal antibody (M03), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRM2.
Información adicional
Size 100 ug
Gene Name GRM2
Gene Alias GLUR2|GPRC1B|MGLUR2|mGlu2
Gene Description glutamate receptor, metabotropic 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRM2 (NP_000830, 414 a.a. ~ 506 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2912
Clone Number 3H7
Iso type IgG2a Kappa

Enviar uma mensagem


GRM2 monoclonal antibody (M03), clone 3H7

GRM2 monoclonal antibody (M03), clone 3H7