GRIN2B polyclonal antibody (A01)
  • GRIN2B polyclonal antibody (A01)

GRIN2B polyclonal antibody (A01)

Ref: AB-H00002904-A01
GRIN2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIN2B.
Información adicional
Size 50 uL
Gene Name GRIN2B
Gene Alias MGC142178|MGC142180|NMDAR2B|NR2B|hNR3
Gene Description glutamate receptor, ionotropic, N-methyl D-aspartate 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIN2B (NP_000825, 127 a.a. ~ 236 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2904

Enviar uma mensagem


GRIN2B polyclonal antibody (A01)

GRIN2B polyclonal antibody (A01)