GRIN1 polyclonal antibody (A01)
  • GRIN1 polyclonal antibody (A01)

GRIN1 polyclonal antibody (A01)

Ref: AB-H00002902-A01
GRIN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIN1.
Información adicional
Size 50 uL
Gene Name GRIN1
Gene Alias NMDA1|NMDAR1|NR1
Gene Description glutamate receptor, ionotropic, N-methyl D-aspartate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIN1 (NP_015566, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2902

Enviar uma mensagem


GRIN1 polyclonal antibody (A01)

GRIN1 polyclonal antibody (A01)