GRIK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • GRIK2 purified MaxPab rabbit polyclonal antibody (D01P)

GRIK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00002898-D01P
GRIK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GRIK2 protein.
Información adicional
Size 100 ug
Gene Name GRIK2
Gene Alias EAA4|GLR6|GLUK6|GLUR6|MGC74427|MRT6
Gene Description glutamate receptor, ionotropic, kainate 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce
Immunogen Prot. Seq MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GRIK2 (AAH63814.1, 1 a.a. ~ 583 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2898

Enviar uma mensagem


GRIK2 purified MaxPab rabbit polyclonal antibody (D01P)

GRIK2 purified MaxPab rabbit polyclonal antibody (D01P)