GRIK1 polyclonal antibody (A01)
  • GRIK1 polyclonal antibody (A01)

GRIK1 polyclonal antibody (A01)

Ref: AB-H00002897-A01
GRIK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRIK1.
Información adicional
Size 50 uL
Gene Name GRIK1
Gene Alias EAA3|EEA3|GLR5|GLUR5
Gene Description glutamate receptor, ionotropic, kainate 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRIK1 (NP_000821, 331 a.a. ~ 440 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2897

Enviar uma mensagem


GRIK1 polyclonal antibody (A01)

GRIK1 polyclonal antibody (A01)