GRID2 monoclonal antibody (M01), clone 1A1
  • GRID2 monoclonal antibody (M01), clone 1A1

GRID2 monoclonal antibody (M01), clone 1A1

Ref: AB-H00002895-M01
GRID2 monoclonal antibody (M01), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRID2.
Información adicional
Size 100 ug
Gene Name GRID2
Gene Alias MGC117022|MGC117023|MGC117024
Gene Description glutamate receptor, ionotropic, delta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRID2 (NP_001501, 908 a.a. ~ 1007 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2895
Clone Number 1A1
Iso type IgG1 Kappa

Enviar uma mensagem


GRID2 monoclonal antibody (M01), clone 1A1

GRID2 monoclonal antibody (M01), clone 1A1