GRID2 polyclonal antibody (A01)
  • GRID2 polyclonal antibody (A01)

GRID2 polyclonal antibody (A01)

Ref: AB-H00002895-A01
GRID2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRID2.
Información adicional
Size 50 uL
Gene Name GRID2
Gene Alias MGC117022|MGC117023|MGC117024
Gene Description glutamate receptor, ionotropic, delta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRID2 (NP_001501, 908 a.a. ~ 1007 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2895

Enviar uma mensagem


GRID2 polyclonal antibody (A01)

GRID2 polyclonal antibody (A01)