GRID1 monoclonal antibody (M02), clone 3A8
  • GRID1 monoclonal antibody (M02), clone 3A8

GRID1 monoclonal antibody (M02), clone 3A8

Ref: AB-H00002894-M02
GRID1 monoclonal antibody (M02), clone 3A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRID1.
Información adicional
Size 100 ug
Gene Name GRID1
Gene Alias KIAA1220
Gene Description glutamate receptor, ionotropic, delta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRID1 (NP_060021, 349 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2894
Clone Number 3A8
Iso type IgG2b Kappa

Enviar uma mensagem


GRID1 monoclonal antibody (M02), clone 3A8

GRID1 monoclonal antibody (M02), clone 3A8