GRID1 polyclonal antibody (A01)
  • GRID1 polyclonal antibody (A01)

GRID1 polyclonal antibody (A01)

Ref: AB-H00002894-A01
GRID1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GRID1.
Información adicional
Size 50 uL
Gene Name GRID1
Gene Alias KIAA1220
Gene Description glutamate receptor, ionotropic, delta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRID1 (NP_060021, 349 a.a. ~ 441 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2894

Enviar uma mensagem


GRID1 polyclonal antibody (A01)

GRID1 polyclonal antibody (A01)