GRB7 monoclonal antibody (M03), clone 3C12
  • GRB7 monoclonal antibody (M03), clone 3C12

GRB7 monoclonal antibody (M03), clone 3C12

Ref: AB-H00002886-M03
GRB7 monoclonal antibody (M03), clone 3C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GRB7.
Información adicional
Size 100 ug
Gene Name GRB7
Gene Alias -
Gene Description growth factor receptor-bound protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq EEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GRB7 (AAH06535, 37 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2886
Clone Number 3C12
Iso type IgG2b Lambda

Enviar uma mensagem


GRB7 monoclonal antibody (M03), clone 3C12

GRB7 monoclonal antibody (M03), clone 3C12