GRB7 MaxPab rabbit polyclonal antibody (D01)
  • GRB7 MaxPab rabbit polyclonal antibody (D01)

GRB7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00002886-D01
GRB7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GRB7 protein.
Información adicional
Size 100 uL
Gene Name GRB7
Gene Alias -
Gene Description growth factor receptor-bound protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GRB7 (NP_001025173.1, 1 a.a. ~ 532 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 2886

Enviar uma mensagem


GRB7 MaxPab rabbit polyclonal antibody (D01)

GRB7 MaxPab rabbit polyclonal antibody (D01)