GPX7 purified MaxPab mouse polyclonal antibody (B01P)
  • GPX7 purified MaxPab mouse polyclonal antibody (B01P)

GPX7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00002882-B01P
GPX7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GPX7 protein.
Información adicional
Size 50 ug
Gene Name GPX7
Gene Alias CL683|FLJ14777|GPX6|NPGPx
Gene Description glutathione peroxidase 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GPX7 (NP_056511.2, 1 a.a. ~ 187 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2882

Enviar uma mensagem


GPX7 purified MaxPab mouse polyclonal antibody (B01P)

GPX7 purified MaxPab mouse polyclonal antibody (B01P)