GPT monoclonal antibody (M04A), clone M1
  • GPT monoclonal antibody (M04A), clone M1

GPT monoclonal antibody (M04A), clone M1

Ref: AB-H00002875-M04A
GPT monoclonal antibody (M04A), clone M1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GPT.
Información adicional
Size 200 uL
Gene Name GPT
Gene Alias AAT1|ALT1|GPT1
Gene Description glutamic-pyruvate transaminase (alanine aminotransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPT (AAH18207.1, 1 a.a. ~ 496 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 2875
Clone Number M1
Iso type IgG1 Kappa

Enviar uma mensagem


GPT monoclonal antibody (M04A), clone M1

GPT monoclonal antibody (M04A), clone M1