GPS2 monoclonal antibody (M01), clone 3C4
  • GPS2 monoclonal antibody (M01), clone 3C4

GPS2 monoclonal antibody (M01), clone 3C4

Ref: AB-H00002874-M01
GPS2 monoclonal antibody (M01), clone 3C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GPS2.
Información adicional
Size 100 ug
Gene Name GPS2
Gene Alias AMF-1|MGC104294|MGC119287|MGC119288|MGC119289
Gene Description G protein pathway suppressor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPS2 (AAH13652, 228 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 2874
Clone Number 3C4
Iso type IgG1 Kappa

Enviar uma mensagem


GPS2 monoclonal antibody (M01), clone 3C4

GPS2 monoclonal antibody (M01), clone 3C4