GPS2 polyclonal antibody (A01)
  • GPS2 polyclonal antibody (A01)

GPS2 polyclonal antibody (A01)

Ref: AB-H00002874-A01
GPS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GPS2.
Información adicional
Size 50 uL
Gene Name GPS2
Gene Alias AMF-1|MGC104294|MGC119287|MGC119288|MGC119289
Gene Description G protein pathway suppressor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPS2 (AAH13652, 228 a.a. ~ 327 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 2874

Enviar uma mensagem


GPS2 polyclonal antibody (A01)

GPS2 polyclonal antibody (A01)